PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000289397
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 616aa    MW: 67207.2 Da    PI: 6.4345
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000289397genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY95.53.6e-30258314259
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    dDgynWrKYGqK+vkg efprsYY+Ct+++C+vkk  ers+ d++++ei+Y+g+H+h 
  MDP0000289397 258 DDGYNWRKYGQKHVKGCEFPRSYYKCTHPNCEVKKLFERSH-DGQITEIIYKGTHDHX 314
                    8****************************************.***************7 PP

2WRKY106.11.8e-33433491159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    ldDgy+WrKYGqK+v+g+++prsYY+Ct agCpv+k+ver+++dpk+v++tYeg+Hnh+
  MDP0000289397 433 LDDGYRWRKYGQKVVRGNPNPRSYYKCTNAGCPVRKHVERASHDPKAVITTYEGKHNHD 491
                    59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1182902.22E-23256316IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.9E-25257316IPR003657WRKY domain
SMARTSM007744.2E-32257315IPR003657WRKY domain
PROSITE profilePS5081121.918258316IPR003657WRKY domain
PfamPF031065.0E-23258313IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.4E-37418493IPR003657WRKY domain
SuperFamilySSF1182902.48E-29425493IPR003657WRKY domain
PROSITE profilePS5081138.825428493IPR003657WRKY domain
SMARTSM007743.1E-39433492IPR003657WRKY domain
PfamPF031063.8E-26434491IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009961Biological Processresponse to 1-aminocyclopropane-1-carboxylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 616 aa     Download sequence    Send to blast
MDATALDHPS GPSDDVDQGL TDFQPGSDPT LFSSSAAASG GAKYKLMSPA KLPISRSPCL  60
TIPHGLSPTS FLESPVLLSN MKVMTLHVXI VIGDDIRCSK HIAITSVVWA EPSPTTGSFL  120
KPQMVYGSLS STTYSTTXVC SDFNTSDERN SGSFEFKPHA RSNMVTTDYN HYGNEQPLQI  180
QGQAQPQSXM SPPLAKNEMA VSSNELSLSA PVHTVTAGAS APAEGDSGEL TQREHPNPGV  240
QTSQCDNKGN GPSVISSDDG YNWRKYGQKH VKGCEFPRSY YKCTHPNCEV KKLFERSHDG  300
QITEIIYKGT HDHXKPQPSR RYNTGAMMPP QEERSDKASS LTVGDDKPSG IYGQMSSNNE  360
PNSTPELSPV TGNDDNVEGT GSLSNRLPDE VDDDDPFSKR RRMDVGGIDV TPIVKPIREP  420
RVVVQTLSEV DILDDGYRWR KYGQKVVRGN PNPRSYYKCT NAGCPVRKHV ERASHDPKAV  480
ITTYEGKHNH DVPTAKTSSH DTSGPITVNV PSRIRSEESD TISLDLGVGT TSGGENRSND  540
HLQLHSELVE RQSHTNSNFR VAQNTPISTY YGVLIGGMNQ YGSRENPSES RSIEVPPLNH  600
SSYPYPQNMG RVLTGP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-36258493877Probable WRKY transcription factor 4
2lex_A2e-36258493877Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.250280.0leaf
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00455DAPTransfer from AT4G26640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009338896.10.0PREDICTED: probable WRKY transcription factor 20
RefseqXP_009338899.10.0PREDICTED: probable WRKY transcription factor 20
SwissprotQ93WV00.0WRK20_ARATH; Probable WRKY transcription factor 20
TrEMBLM5X2W20.0M5X2W2_PRUPE; Uncharacterized protein
STRINGVIT_19s0090g01720.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39463463
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.20.0WRKY family protein